- PER2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49316
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- PER2
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: LSIFQSHCHY YLQERSKGQP SERTAPGLRN TSGIDSPWKK TGKNRKLKSK RVKPRDSSES TGSGGPVSAR PPLVGLNATA WSPSDTSQSS CPA
- period circadian regulator 2
- FASPS, FASPS1
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cancer, Chromatin Research, Circadian Rhythm, Endothelial Cell Markers, Hypoxia, Lipid and Metabolism, Neuroscience, Signal Transduction, Transcription Factors and Regulators, Vision
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPA
Specifications/Features
Available conjugates: Unconjugated